Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1191607::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOuter membrane protein F
Gene name
SpeciesKlebsiella pneumoniae IS46
NCBI taxonomy1432553
Protein sequence

MVIPALLVAGAANAAEIYNKNGNKLDFYGKMVGEHVWTTNGDTSSDDTTYARIGLKGETQ
INDQLIGYGQWEYNMDASNVEGSQTTKTRLAFAGLKAGEYGSFDYGRNYGAIYDVEAATD
MLVEWGGDGWNYTDNYMTGRTNGVATYRNSDFFGLVDGLSFALQYQGKNDHDRAIRKQNG
DGFSTAATYAFDNGIALSAGYSSSNRSVDQKADGNGDKAEAWATSAKYDANNIYAAVMYS
QTYNMTPEEDNHFAGKTQNFEAVVQYQFDFGLRPSIGYVQTKGKDLQSRAGFSGGDADLV
KYIEVGTWYYFNKNMNVYAAYKFNQLDDNDYTKAAGVATDDQAAVGIVYQF
Sequence length351 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotW1E8X3
PDB5O77
PfamPF00267
EMBLCBWL010000897
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-13
Sequence

MVIPALLVAGAAN
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMIII
IIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOOOOOOOO
OOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMM
OOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen