Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1176868::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOmpK37
Gene nameName=ompK37, Synonyms=ompN_1, ompN_2, ORFNames=BANRA_00477, C2U49_03740, C3F39_02150, C7V41_10070, DD581_25170, F1D54_16730, F3G17_05820, FAT93_19650, FCH06_004220, FKC87_21280, FXN67_16010, G4V15_14000, G4V19_17965, G4V26_15765, G5626_07080, GZH28_12045, NCTC11679_03052, NCTC13465_01341, NCTC13635_00771, SAMEA104567806_00300, SAMEA104567853_02786, SAMEA1712987_03398, SAMEA3649466_03503, SAMEA3673128_03600, SAMEA3729660_03834, SAMEA4873575_02200
SpeciesKlebsiella pneumoniae
NCBI taxonomy573
Protein sequence

MKRKVLALVIPALLAAGAAHAAEIYNKDGNKLDLYGKVDGLHYFSSDSKKDGDQTYLRFG
FKGETQINDMLTGYGQWEYNVQANNTETSSDQAWTRLAFAGIKVGDYGSFDYGRNYGVLY
DVEGWTDMLPEFGGDSYTYADNFMAGRANGVATYRNSDFFGLVEGLNFALQYQGKNEGQN
AQDINVGTNNRSSDSDVRFDNGDGFGLSTSYDFGMGISAAAAYTSSDRTNDQMTQTNARG
DKAEAWTAGLKYDANDIYLATMYSETRNMTPYGNDGVANKTQNFEVTAQYQFDFGLRPAI
SYLQSKGKDLYNNGRYADKDLVKYMDVGATYYFNRNMSTYVDYKINLLDGNDKFYEDNGI
STDNIVALGLVYQF
Sequence length374 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotS5UCA2
PDB6V78
PfamPF00267
EMBLKC195784 | KC534862 | KC534865 | KC534868 | CP026178 | CP026392 | VUBL01000026 | VWRE01000002 | JAAFZD010000011 | JAAJSW010000003 | JAAKYI010000008 | JAAKYT010000007 | JAAKYP010000006 | PYBH01000006 | QFMH01000326 | UAWQ01000009 | UGMG01000001 | UITM01000011 | UJGS01000017 | UJRJ01000012 | STEC01000037 | VIAJ01000017 | VSSY01000013 | SUOY02000003 | UNZU01000011 | UWXT01000001 | LR134162 | CAAGWD010000001 | CAAGXW010000008 | CAAGZV010000003
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-21
Sequence

MKRKVLALVIPALLAAGAAHA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOO
OOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen