Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164222::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionFerric enterobactin receptor PirA
Gene nameName=pirA, OrderedLocusNames=PA0931
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MYPQFRRGHLAAAVLFASSSLLGGQALAEDERLEELDERAESVVQLGDEVVLGTAEQELK
QAPGVSIITAEDIRKRPPVNDLSEIIRTMPGVNLTGNSSSGQRGNNRQIDIRGMGPENTL
ILVDGKPVSSRNSVRYGWRGERDTRGDSNWVPPEEVERIEVLRGPAAARYGSGAAGGVVN
IITKRPTDRLRGSMTVFTNIPESSKDGATRRANFSLSGPLTEALSFRAYGSANKTDSDDT
DINLGHTVNPSRTVAGREGVRNRDLSGMLSWQVTPDQVVDFEAGFSRQGNIYAGDTQNNN
GTANTQGLADDGAETNRMYRENYAITHNGTWSFGTSRFVAQYDSTRNNRLEEGLAGSVEG
QIGADRSFSASKLENYRLSGELNLPLHALFEQVLTVGAEWNKETLNDPSSLKQGFVGSDS
LPGTPAAGSRSPKSKAEIRALYVEDNIELRPGTMLTPGLRLDDHSDFGLNWSPSLNASQT
LGEYFTVKAGIARAFKAPNLYQSNPNYLLYTRGNGCPIQTSSGGCYLVGNENLDAETSVN
KELGIEFRRDGWVAGLTYFRNDYKNKIVAPLDVMGQTGTGNNILQWSNAKKAVVEGLEGN
LLVPLHEDLSWSTNLTYMLQSKDKDTGNPLSVIPEYTLNSTLDWQASERLSTQLTSTIYG
RQEPPKHGTSRNTPVVSRKEVGTYGIWGVSAGYTFSENLSVRGGVSNLFDKRLYRQGNSF
DAGAATYNEPGRAYYVSMTTSF
Sequence length742 AA
FragmentNo
pHHM coverage94.13 %
Cross-references
UniprotQ9I527
PDB5FP2
PfamPF07715 | PF00593
EMBLAE004091
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531 | IPR036942 | IPR010917 | IPR010105
PROSITEPS01156
PIRH83529
Signal peptide annotation
Amino acids1-28
Sequence

MYPQFRRGHLAAAVLFASSSLLGGQALA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMO
OOOOOOOOOOOOMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOMMMMMMMMI
IIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
MMMMMMMIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMM
MMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen