Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164171::      
Protein information
OMPdb FamilyThe Outer Membrane Porin (OprD) Family
Protein descriptionProbable porin
Gene nameOrderedLocusNames=PA3588
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MNNNKKCAFFLLPILAGDSVPALAEGFLEDSRASLALRNFYMNRDFRDGAGRAKSEEWAQ
GFLFDYRSGYTEGTLGVGLDLLGKLGVRLDSGAGRSGTGLLPLRDDGSAAGDYARLDATA
KLRLSRSELKVGGLVPKLPTIQPNYGRLFPQVFQGALLTSGELSGLSLNLGRLTEVSQRN
EAGTSDLALFNRNRRFAGAAQADRFDLAGLDYRIAPDWTGSYHYGELEQVYAQHFLGLKG
RIGIAADSLESDLRLALSRDTGGARGGRIDNRSFSGSLTYRLRNGQAFGLGYQRMSGDHG
FPYLEGTDPYLVNFGQYNDFAEAGESSWQLRYDCDFAPLGVPGLSLMTRYFSGHGAKPKG
ADGSREWERDSDLRYVLQGGALKGLGLVWRNATYRSAFSRDIDENRLYLTYELPLF
Sequence length416 AA
FragmentNo
pHHM coverage99.75 %
Cross-references
UniprotQ9HY38
PDB4FSP
PfamPF03573
EMBLAE004091
InterProIPR005318 | IPR023614
PIRF83197
Signal peptide annotation
Amino acids1-24
Sequence

MNNNKKCAFFLLPILAGDSVPALA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOMMM
MMMMMMMMIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMM
MMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMMOOOOOOOMMMMMMMM
IIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMMOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIMMMMMMMMMOOOOOOOO
OOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOMMMMMMMMMIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen