Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164133::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Treponema pectinovorum ATCC 33768 mompA Family
Protein descriptionMajor outer membrane protein
Gene nameName=mompA
SpeciesTreponema pectinovorum
NCBI taxonomy164
Protein sequence

MKKIIGTVLLAVTGLSLVAADVTVNINSRVRPNLYTTSKKEDGKKTSELFKLDGAKAADT
VKIAASNAYAGAVLESTWDAGAAAPGVELDNYYGWMNFGNLAITAGKYDSRYTARFNSSA
TEGGLVDSDIAKYGLSNKIATGLNGAGTALKTVGKTWLYDFDNASAFKGSKDLSLTFAYT
LADVAGGKLLLKASLVKNAYDSATNSDGDTFTQSAGYVAEAAWNGKGLTFDFIFKNPENK
GFGVGLYSTVKINDNNSAAVGVTYGTKKDELDTALAVDGRYKFTSGPLIATLAAKYSYAK
PKGFDAETALEAGTEVSYMVNNLVTVALDARLDMCDLDDNDKKDLAENVIVISPRAKFTA
GKGAAVTVAVEYTQALNSSKDVATYNPVKTKIGVPVIFRVKM
Sequence length402 AA
FragmentNo
pHHM coverage0.00 %
Cross-references
UniprotQ9FCY2
EMBLAY007192
Signal peptide annotation
Amino acids1-19
Sequence

MKKIIGTVLLAVTGLSLVA
Annotation sourceExperimentally verified
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMM
MIIIIIIIMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMMMMMMIIIIMMMMMMMOOOOOO
OMMMMMMMMMMMIIIIIMMMMMMMMMOOOOOOMMMMMMMMMMMIIIIMMMMMMMMMMMOO
OOOOOOOOOMMMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMII
IIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMMM
Annotation reliability0.91
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen