Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1158674::      
Protein information
OMPdb FamilyThe SprA Family
Protein descriptionSprA
Gene nameName=sprA, OrderedLocusNames=Fjoh_1653
SpeciesFlavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) (Cytophagajohnsonae)
NCBI taxonomy376686
Protein sequence

MRKICIFLLVLFCGNVLRSQVKPAVQDTTKTQFSVGKMELENPPSILSAYKYDPITDRYI
YTTSVDGFSIDYPLVLTPKEYEDLLLKESRRDYFRKKMDAIDGKKTGAEAAKKDLLPRYY
INSSLFESIFGSNTIDVKPTGSVEMDLGVRYTKQDNPAFSPRNRSSLTFDFDQRISMSLM
GKIGTRLEVNANYDTQSTFAFQNLFKLAYTPSEDDIIQKVEVGNVSMPLNSTLIRGAQSL
FGVKTQLQFGRTTITGVFSEQKSQTKSVVAENGGTVQNFDLYALDYDNDRHFFLSQYFRN
KYDVSLKNYPFIDSRVQITRLEVWVTNKQNRVTTTGGGNNLRNIIALQDLGEAQVSGVPD
NEVVVISSTAGFFNNPIDSPTSNTNNKYDPATIGQAGSFLNSNIREIVTAKSGFNNTNVS
EATDYSVLENARKLTTNEYTFNPQLGYISLQQRLANDEILAVAFEYTVGGKVYQVGEFGS
DGVDATVVTGNNSSNQAIITQSLVLKMLKSNLTNVKNPVWNLMMKNVYQIPQAYQIKQDD
FRLNILYTDPSPINYITPVQGSSFPPNPAPDSKVEQTPLLNVFNLDRLNYNNDPQAGGDG
FFDYIPGVTVDVQNGRVIFTTKEPFGELIFNKLQTGAGESYNDPTTYNANQQKYVFRNMY
RNTQAGALQDSDKNKFLLRGKYKSSGSNGIPIGAFNVPQGSVVVTAAGRVLVEGIDYSVD
YQLGRVQILDPSLQASNTPIEVSLENNSIFGQQTRRFMGFNIEHKISDKFVIGGTYLKMT
ERPFTQKSTYGQESVNNTIFGFNGNYSTEVPFLTRLANKLPNIDTDVPSNLSIRGEVAFL
RPDAPKASDFQGEATIYVDDFEGSQSTIDMRSAYAWSLASTPFITSINDNTFNANSNTLE
YGFKRAKLSWYTIDPVFYSSKPSGISNDDLSLNTTRRIYSRELYPNTDIAQGQIQVVNTL
DLTYYPGERGPYNNNPSFGASNPSANFGGIMRALNSTNFEQGNVEYIQFWVLDPYVGNGE
SPATNAGKIYFNLGEISEDVLKDGRKQYENGLGPDQVMVNPQPLWGDVPASQSLIYAFDT
NPDNRKNQDVGLDGLPSSREGSIYTNYAGEADPAGDDYTYYLNADGGVLERYKNYNGTEG
NSAVSINDPNRGSTTLPDVEDINRDNTMSTINAYYEYSIDVKPGMQVGENYITDIREVTN
VDLPNGGTTNARWIQFKIPVSQPQNTIGNITDFRSIRFMRMFMTGFNSQMTVRFGALDLV
RGEWRRYTGTLDANDQNPDDDGVEFDVAAVNIQENGTKCPVNYVMPPGVQREQLYNNNTV
INQNEQALAVRIGGAGLQYQDSRAVFKNVSVDMRQYKKLKMFLHAESLPNQPTLEDDEMV
GFIRFGNDFTQNFYQVEIPLKVTKTGGSCSISPDLVWMDDNSIDLALDLLTRMKIKAMSI
DINSSKRDVNGIYYPDNDPDLEGGDGDGKLTLGIKGNPNFGLVRNLMVGVKSRADHKDIK
GEVWFNELRLADLENKGGMAAILNVDTNMADFATVSATGRKSTIGFGSLEQGANERDRED
VQQYNIVTNLNLGKLLPKKWGINLPFNYAIGEEVITPEYDPFNQDIKLDQLIRETTDQAE
KDNIRTRAIDYTKRKSINFIGVRKDRAPEQKPHVYDIENFTFSQSYNQVERHDYEVADYE
DEQSNSAVNYAYTFQPKEVVPFKSTKFMKKSEYWKLLSDFNFNYLPSNISFNTNILRQSN
RQQFREVEVEGIGLDPLYRRNFAFNYQYGFGFNLTKSLKLNYSATSNNIVRNFLNDDNSP
KEDFNIWDDYLDIGTPNQHAQQLVLNYDIPINKIPIFGFVKASYSYTADYMWQRSSTAFS
EYEDPNGTVYDLGNTIQNSNSNTLTTTLNMNTLYKYLGLTPGAKKTAKPKTAAPPKPGEK
IVNTAKPVVSSSPFYDGLIGVLTSIKNVQINYTKNSGTVLPGYTPSVGFLGTSKPSLGFV
FGSQDDVRYEAAKRGWLTTYQDFNQSFTQVSNKLLKVTANIDLLPDLKVDLSMDRSYSEN
TSEQYSVDPSTNEYKPLSPYTYGMFSISTVMIKTAFSPSDETQSAAFDDFRSNRLIIANR
LAEGHYGSGVAIPRYGDANNPIPAETDPNYAVYTANQGYPIGYTKSNQAVLLPAFLAAYT
GSDASSSSTNIFRSFPIPNWSIKYNGLMRYKYFKDKFKRFSLQHNYRASYTINQFRSNFD
YNSSPKVQDVNTNFYNEIIMSNVNLVEQFSPLIRMDFELKSSLRVLSEIKKDRALSMSFD
NNLLTEVKGMEYIIGLGYRFKDVIFSSRLADNPTGIIKSDINIKADFSLRNNETLVRYLD
YDNNQLAAGQNIWSLKLTADYSFSKNLTAIFYYDHSFSKAVISTSFPLTNIRSGFTLRYN
FGN
Sequence length2403 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ5I6C7
PDB6H3I | 6H3J
PfamPF14349
EMBLAY850225 | CP000685
InterProIPR026377 | IPR025684
Signal peptide annotation
Amino acids1-18
Sequence

MRKICIFLLVLFCGNVLR
Annotation sourceExperimentally verified
TM annotation
# beta strands36
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMMMIII
IIIIIIIIIIMMMMMMOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOO
MMMMMMMIIIIIIMMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIIMMMMMMMMMM
OOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMIIIIIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMMMMIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOO
OOMMMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIMMMMMMMMMOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIIIIIIIIIIMMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMMMMIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIIIIMMMMMMMMOOOOOOOOO
OOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOMMMMMMMMII
III
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen