Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1158165::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Protein beta-barrel domain Family
Protein descriptionOuter membrane protein H1
Gene nameName=oprH, ORFNames=C0044_08900, CAZ10_07205, CGU42_27370, DT376_23360, DY930_05700, DZ962_29125, E4V10_28055, ECC04_023125, EQH76_04770, F3H14_22240, F7O90_07865, F7O93_13815, F7O98_23010, FDK04_21295, GNQ48_03675, IPC116_05535, IPC1323_20930, IPC1481_31800, IPC1509_26465, IPC36_06040, IPC584_04195, IPC669_14150, NCTC10662_03435, NCTC12934_05653, NCTC13437_06880, NCTC13619_02495, NCTC13621_01139, PaeAG1_04568, PAMH19_4523, RW109_RW109_04992
SpeciesPseudomonas aeruginosa
NCBI taxonomy287
Protein sequence

MKALKTLFIATALLGSAAGVQAADNFVGLTWGETSNNIQKSKSLNRNLNSPNLDKVIDNT
GTWGIRAGQQFEQGRYYATYENISDTSSGNKLRQQNLLGSYDAFLPIGDNNTKLFGGATL
GLVKLEQDGKGFKRDSDVGYAAGLQAGILQELSKNASIEGGYRYLRTNASTEMTPHGGNK
LGSLDLHSSSQFYLGANYKF
Sequence length200 AA
FragmentNo
pHHM coverage99.44 %
Cross-references
UniprotQ51486
PDB2LHF
PfamPF13505
EMBLM26954 | CDAZ01000013 | VWQL01000027 | VZIM01000013 | VZIP01000111 | VZIW01000058 | WOAD01000001 | NFFZ01000003 | NMRQ01000050 | QHLU01000667 | CP045739 | CP039990 | QORE01000926 | QVBL01000060 | NSVB01000007 | RXTB01000023 | SBJW01000002 | LT969520 | RWMJ01000014 | RWNG01000034 | RWOM01000009 | RWQO01000001 | RWTJ01000002 | RWUZ01000002 | SRHR01000055 | RHMD02000002 | CAADJI010000001 | CAADJP010000006 | CAADJO010000003 | CAADJS010000003 | CABEEH010000489
InterProIPR017690 | IPR011250 | IPR027385
PIRA44762
Signal peptide annotation
Amino acids1-22
Sequence

MKALKTLFIATALLGSAAGVQA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOM
MMMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMMMIIIIIIIIMMMMMMMM
MMMOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIMMMMMMMMMMMMMMMMMMMMMMMMM
MMMOOOMMMMMMMMMMMMII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen