Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1157807::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Porin (OprD) Family
Protein descriptionOuter membrane porin, OprD family
Gene nameOrderedLocusNames=PFL_1329
SpeciesPseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
NCBI taxonomy220664
Protein sequence

MKPSTPPSYLLPSLLALALSSTALPALAAESGFLEDAQANLTLRNFYFNRNFTNPTKAQG
KAEEWTQSFILDAKSGFTQGTVGFGMDVLGLYSLKLDGGKGTGGTQLLPLDHDGRPADNF
GRLGVAFKARLSQTEVKVGEWMPVLPILRSDDGRSLPQTFRGGQITSKEIAGLTLYGGQF
RANSPRDDSSMSDMSMFGKAAFTSDRFNFQGAEYAFNDKRTQIALWNAQLKDIYSQQFIN
LIHSQPLGDWTLGANLGFFYGKEDGSARAGDMENRTWSGLFSAKYGGNTFYVGLQKLTGD
SAWMRVNGTSGGTLANDSYNASYDNAKEKSWQVRHDYNFAALGVPGLTLMNRYISGSNVH
TATVSDGKEWGRESEVAYTVQSGTLKNLNLKWRNSTMRRDFSNNEFDENRLIISYPLSLL
Sequence length420 AA
FragmentNo
pHHM coverage99.75 %
Cross-references
UniprotQ4KH25
PDB3JTY
PfamPF03573
EMBLCP000076
InterProIPR005318 | IPR023614
Signal peptide annotation
Amino acids1-28
Sequence

MKPSTPPSYLLPSLLALALSSTALPALA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOO
OOOOMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
MMMMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIMMMMMMMOOOOOOOMMMMM
MMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIMMMMMMMMMOOOOO
OOOOOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen