Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151701::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionAlginate_exp domain-containing protein
Gene nameOrderedLocusNames=LBJ_0227
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MSSRALPAVPFLLLSSCLLANAVHAAGQGDGSVIELGEQTVVATAQEETKQAPGVSIITA
EDIAKRPPSNDLSQIIRTMPGVNLTGNSSSGQRGNNRQIDIRGMGPENTLILVDGKPVSS
RNSVRYGWRGERDSRGDTNWVPADQVERIEVIRGPAAARYGNGAAGGVVNIITKQAGAET
HGNLSVYSNFPQHKAEGASERMSFGLNGPLTENLSYRVYGNIAKTDSDDWDINAGHESNR
TGKQAGTLPAGREGVRNKDIDGLLSWRLTPEQTLEFEAGFSRQGNIYTGDTQNTNSNNYV
KQMLGHETNRMYRETYSVTHRGEWDFGSSLAYLQYEKTRNSRINEGLAGGTEGIFDPNNA
GFYTATLRDLTAHGEVNLPLHLGYEQTLTLGSEWTEQKLDDPSSNTQNTEEGGSIPGLAG
KNRSSSSSARIFSLFAEDNIELMPGTMLTPGLRWDHHDIVGDNWSPSLNLSHALTERVTL
KAGIARAYKAPNLYQLNPDYLLYSRGQGCYGQSTSCYLRGNDGLKAETSVNKELGIEYSH
DGLVAGLTYFRNDYKNKIESGLSPVDHASGGKGDYANAAIYQWENVPKAVVEGLEGTLTL
PLADGLKWSNNLTYMLQSKNKETGDVLSVTPRYTLNSMLDWQATDDLSLQATVTWYGKQK
PKKYDYHGDRVTGSANDQLSPYAIAGLGGTYRLSKNLSLGAGVDNLFDKRLFRAGNAQGV
VGIDGAGAATYNEPGRTFYTSLTASF
Sequence length746 AA
FragmentNo
pHHM coverage98.24 %
Cross-references
UniprotQ05098
PDB5M9B | 5MZS | 5NC3 | 5NC4 | 5NR2 | 5OUT | 6I2J | 6Q5E | 6R1F
PfamPF07715 | PF00593
EMBLM98033 | AE004091
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531 | IPR036942 | IPR010917 | IPR010105
PROSITEPS01156
PIRA40636
Signal peptide annotation
Amino acids1-25
Sequence

MSSRALPAVPFLLLSSCLLANAVHA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOO
OOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMMMMMMMMMM
MMMMMIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OMMMMMMMIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOMMMMMMMMIIIIIMMM
MMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMII
IIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMM
IIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen