Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151294::      
Protein information
OMPdb FamilyThe Pseudomonas OprP Porin (POP) Family
Protein descriptionBacteriophage adsorption protein A
Gene nameName=lptD, Synonyms=impostAyabG
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MIRKHSLGFVASALALAVSAQAFAGTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQ
ADYSRFDGFYTKNGNTADAAYFRRAFIELGGTAYKDWKYQINFDLSHNTGSSDNGYFDEA
SVTYTGFNPVNLKFGRFDPDFGLEKATSSKWVTAPERNAAYELADWINTHQDGMGAQVNS
TLADMAYLSAGVSAKDADDSDGDSVKQFNFRGVFAPMHEAGNVLHVGVNYAYRDLDDTAF
DSRIRPRLGMRGIATSGGNDAGDNGNRATFGGVSNSPAGSYKDDSVWGLEGAWAMGPFSA
QAEYLARKLKADDNAYKDIKAKGYYAQLAYTLTGESRQYKLEGAKFDSVKPENKEIGAWE
VFYRYDNIKVEDDNVVADTATREVGDTKAKAHNLGVNWYVNDAVKISAAYVKAKTDKITN
NNGDDDGDGFVTRLQYVF
Sequence length438 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP32977
PDB4RJW | 4RJX
PfamPF07396
EMBLM86648 | AE004091
InterProIPR023614 | IPR010870
PIRS25260
Signal peptide annotation
Amino acids1-24
Sequence

MIRKHSLGFVASALALAVSAQAFA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMM
MMMOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMMOOOOMMMMMM
MMMIIIIIIIMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMM
IIIIIMMMMMMMMOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMM
MMMMOOOOOOOOOOOOOOOOOOOOMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIIIIMM
MMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMIIIIIMMMMMMMOOOOOOOOOO
OOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen