Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151285::      
Protein information
OMPdb FamilyThe Imp/OstA Family
Protein descriptionLPS-assembly protein LptD
Gene nameName=lptD, Synonyms=impostAyabG, Name=lptD, Synonyms=impostAyabG
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAK
GDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILK
GPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTW
SVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNY
FEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYED
EHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFS
VGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNT
RDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHYQQTNLDWYNSRNTTKLDESVNR
VMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGL
FRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWEND
DKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYRYAS
PEYIQATLPKYYSTAEQYKNGISQVGAVASWPIADRWSIVGAYYYDTNANKQADSMLGVQ
YSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPY
QNTL
Sequence length784 AA
FragmentNo
pHHM coverage99.74 %
Cross-references
UniprotP31554
PDB4RHB
PfamPF04453 | PF03968
EMBLAB013134 | U00096 | AP009048
InterProIPR020889 | IPR007543 | IPR005653
PIRF64726
Signal peptide annotation
Amino acids1-24
Sequence

MKKRIPTLLATMIATALYSQQGLA
Annotation sourceExperimentally verified
TM annotation
# beta strands26
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOO
OMMMMMMMMMIIIIIIMMMMMMMMOOOOOOMMMMMMMMIIIMMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMM
MMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOO
OOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMM
IIIIIIIMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIIIII
IIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen