Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151252::      
Protein information
OMPdb FamilyThe TOM40 Family
Protein descriptionMitochondrial distribution and morphology protein 10
Gene nameName=MDM10, OrderedLocusNames=YAL010C, Name=MDM10, OrderedLocusNames=YAL010C
SpeciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
NCBI taxonomy559292
Protein sequence

MSAPTPLAEASQIPTIPALSPLTAKQSKGNFFSSNPISSFVVDTYKQLHSHRQSLELVNP
GTVENLNKEVSRDVFLSQYFFTGLRADLNKAFSMNPAFQTSHTFSIGSQALPKYAFSALF
ANDNLFAQGNIDNDLSVSGRLNYGWDKKNISKVNLQISDGQPTMCQLEQDYQASDFSVNV
KTLNPSFSEKGEFTGVAVASFLQSVTPQLALGLETLYSRTDGSAPGDAGVSYLTRYVSKK
QDWIFSGQLQANGALIASLWRKVAQNVEAGIETTLQAGMVPITDPLMGTPIGIQPTVEGS
TTIGAKYEYRQSVYRGTLDSNGKVACFLERKVLPTLSVLFCGEIDHFKNDTKIGCGLQFE
TAGNQELLMLQQGLDADGNPLQALPQL
Sequence length387 AA
FragmentNo
pHHM coverage99.69 %
Cross-references
UniprotP23644
PDB6JNF | 6UCU | 6UCV
PfamPF01459
EMBLX56885 | Z48755 | AY693021 | BK006946
InterProIPR023614 | IPR027246 | IPR037930 | IPR005686
PIRS12773
Signal peptide annotation
No information available
TM annotation
# beta strands19
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOMMMMMMMIIIIIIIIMMMMMMM
OOOOOMMMMMMMIIIIIIMMMMMMMOOOOOMMMMMMIIIIIIMMMMMMMMMOOOOOMMMM
MMMMMIIIIIIIIIIMMMMMMMMOOOOOOMMMMMMMMIIIIIIIIIIIMMMMMMMMMOOO
OOMMMMMMMMMIIIMMMMMMMMMOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIII
MMMMMMMMOOOMMMMMMMMIIIIIMMMMMMMMOOMMMMMMMMIIIIIIIIIIIIMMMMMM
MOOOOOOOOOOOOOOOOOOOOOOOOOO
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen