Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151248::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Sugar Porin (SP) Family
Protein descriptionMitochondrial distribution and morphology protein 10
Gene nameName=MDM10, OrderedLocusNames=YAL010C
SpeciesSalmonella typhimurium
NCBI taxonomy90371
Protein sequence

MYRKSTLAMLIALLTSAASAHAQTDISTIEARLNALEKRLQEAENRAQTAENRAGAAEKK
VQQLTAQQQKNQNSTQEVAQRTARLEKKADDKSGFEFHGYARSGVIMNDSGASTKSGAYI
TPAGETGGAIGRLGNQADTYVEMNLEHKQTLDNGATTRFKVMVADGQTSYNDWTASTSDL
NVRQAFVELGNLPTFAGPFKGSTLWAGKRFDRDNFDIHWIDSDVVFLAGTGGGIYDVKWN
DGLRSNFSLYGRNFGDIDDSSNSVQNYILTMNHFAGPLQMMVSGLRAKDNDERKDSNGNL
AKGDAANTGVHALLGLHNDSFYGLRDGSSKTALLYGHGLGAEVKGIGSDGALRPGADTWR
IASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQNFALAYEGSYQ
YMDLKPEGYNDRQAVNGSFYKLTFAPTFKVGSIGDFFSRPEIRFYTSWMDWSKKLNNYAS
DDALGSDGFNSGGEWSFGVQMETWF
Sequence length505 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP22340
PDB1A0S | 1A0T | 1OH2
PfamPF02264 | PF11471
EMBLM38416 | X57400
InterProIPR021570 | IPR003192 | IPR036998
PIRA39127 | S15193
Signal peptide annotation
Amino acids1-22
Sequence

MYRKSTLAMLIALLTSAASAHA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIMMMMMMMMMMMMMMMMOOMMM
MMMMMMMIIIIIIIIIIIIIIIIIMMMMMMOOOOOOOOOOOOOOOMMMMMMMMMIIIIII
IIIIIMMMMMMMOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMOOOOOOOOOOOOOOO
OOOOOOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIMMMMMMMM
OOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen