Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151208::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Intimin/Invasin Family
Protein descriptionFerric-anguibactin receptor FatA
Gene nameName=fatA
SpeciesYersinia pseudotuberculosis serotype I (strain IP32953)
NCBI taxonomy273123
Protein sequence

MVFQPISEFLLIRNAGMSMYFNKIISFNIISRIVICIFLICGMFMAGASEKYDANAPQQV
QPYSVSSSAFENLHPNNEMESSINPFSASDTERNAAIIDRANKEQETEAVNKMISTGARL
AASGRASDVAHSMVGDAVNQEIKQWLNRFGTAQVNLNFDKNFSLKESSLDWLAPWYDSAS
FLFFSQLGIRNKDSRNTLNLGVGIRTLENGWLYGLNTFYDNDLTGHNHRIGLGAEAWTDY
LQLAANGYFRLNGWHSSRDFSDYKERPATGGDLRANAYLPALPQLGGKLMYEQYTGERVA
LFGKDNLQRNPYAVTAGINYTPVPLLTVGVDQRMGKSSKHETQWNLQMNYRLGESFQSQL
SPSAVAGTRLLAESRYNLVDRNNNIVLEYQKQQVVKLTLSPATISGLPGQVYQVNAQVQG
ASAVREIVWSDAELIAAGGTLTPLSTTQFNLVLPPYKRTAQVSRVTDDLTANFYSLSALA
VDHQGNRSNSFTLSVTVQQPQLTLTAAVIGDGAPANGKTAITVEFTVADFEGKPLAGQEV
VITTNNGALPNKITEKTDANGVARIALTNTTDGVTVVTAEVEGQRQSVDTHFVKGTIAAD
KSTLAAVPTSIIADGLMASTITLELKDTYGDPQAGANVAFDTTLGNMGVITDHNDGTYSA
PLTSTTLGVATVTVKVDGAAFSVPSVTVNFTADPIPDAGRSSFTVSTPDILADGTMSSTL
SFVPVDKNGHFISGMQGLSFTQNGVPVSISPITEQPDSYTATVVGNTAGDVTITPQVDTL
ILSTLQKKISLFPVPTLTGILVNGQNFATDKGFPKTIFKNATFQLQMDNDVANNTQYEWS
SSFTPNVSVNDQGQVTITYQTYSEVAVTAKSKKFPSYSVSYRFYPNRWIYDGGTSLVSSL
EASRQCQGSDMSAVLESSRATNGTRAPDGTLWGEWGSLTAYSSDWQSGEYWVKKTSTDFE
TMNMDTGALVQGPAYLAFPLCALAI
Sequence length985 AA
FragmentNo
pHHM coverage95.29 %
Cross-references
UniprotP11922
PDB1CWV | 4E1T
PfamPF02369 | PF11924 | PF07979 | PF09134
EMBLM17448 | BX936398
InterProIPR003344 | IPR016186 | IPR016187 | IPR024519 | IPR038177 | IPR013783 | IPR003535 | IPR013117 | IPR008964 | IPR015217
SMARTSM00634
PROSITEPS51127
PRINTSPR01369
PIRA29646
Signal peptide annotation
No information available
TM annotation
# beta strands12
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOMMMMMMMMIIIIIII
IIMMMMMMMMOOOOOOOMMMMMMMMIIIIIIIMMMMMMMOOOOOOOOOOOMMMMMMMIII
MMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIMMMMMMMOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMIIIIMMMMMMMOOOOOOOOOOMMMMMMMMIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen