Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151159::      
Protein information
OMPdb FamilyThe OmpW Family
Protein descriptionOuter membrane protein A
Gene nameName=ompA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MKKLTVAALAVTTLLSGSAFAHEAGEFFMRAGSATVRPTEGAGGTLGSLGGFSVTNNTQL
GLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPY
VGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDI
DTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF
Sequence length212 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP0A915
PDB2F1T | 2F1V
PfamPF03922
EMBLX13583 | U00096 | AP009048 | U24195 | U24196 | U24197 | U24198 | U24199 | U24200 | U24201 | U24202 | U24203 | U24204 | U24205 | U24206
InterProIPR011250 | IPR005618
PIRS07797 | T45501
Signal peptide annotation
Amino acids1-21
Sequence

MKKLTVAALAVTTLLSGSAFA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOMMMM
MMMMMMMIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMMMMMIIIIIIMMMM
MMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMMMIIIMMMMMMMMMMMM
MOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen