Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1087566::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOuter membrane porin protein OmpD
Gene nameName=ompD, ORFNames=NCTC11800_03311
SpeciesProvidencia stuartii
NCBI taxonomy588
Protein sequence

MKKKTILAVTICTLFAAGVTNAAEVYNKDGNKLDVYGQIDVRHYFADAKSGEDGDDSRVR
LGFKGDTQITDQLIGFGRFEWETSTNKAETSNDNQNRLAYAGLKFADYGSLDYGRNYGVI
YDTNAWTDVLPLWGADTMDQEDTFMMGRNRNLLTYRNNNGFGYIDGLSFALQYQGKNGDQ
NKSTGSSALDNNGDGYGFSTAYELGWGLSIGGGYSNSSRTPSQNNIKTGATGKRAEAWNV
GSKLELDELYLAAMYGQTLNTTRFGDDDAEAIANKTENLELVALYSFDFGLTPSIGYNQS
KGKNLGNYGNKDLVKYIAVGASYDFNKNMAAVIDYKINLLKDNQFTDDYGINTDNVLGLG
LIYQF
Sequence length365 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotE3U905
PDB4D65
PfamPF00267
EMBLHM070419 | UGUC01000002
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-22
Sequence

MKKKTILAVTICTLFAAGVTNA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOO
OOOOOOOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOO
OOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMM
MMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen