Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1070144::      
Protein information
OMPdb FamilyThe Autotransporter (AT) Family
Protein descriptionFapF
Gene nameName=fapF, ORFNames=PSUK4_00060
SpeciesPseudomonas sp. UK4
NCBI taxonomy452680
Protein sequence

MHRSLSLRAVVCLSTLLPASLLYAAPDVDIETLKQELLELKQRYEAQQKALAVLEQRVRQ
VEDQPATPAPKRLAKSPADFKQSGSTVAASSGTGGATGGSSYGQSLKDDSEPAQSVSNLY
NEASGFFGNGKFSFETGITYARYDARQLTLNGFLALDSIFLGNINLDRIKADNWTLDLTG
RYNLDNRWQFDVNVPVVYRESTYQSGGASGGDPQATSEESVSRDPTIGDVNFGIAYKFLD
ESATMPDAVVSVRVKAPTGKEPFGIKLVRSTANDNLYVPESLPTGNGVWSITPGLSLVKT
FDPAVLFGSVSYTHNLEDSFDDISSDVNQKVGGKVRLGDSFQFGVGVAFALNERMSMSFS
VSDLIQRKSKLKPDGGGWQSIVSSDANAGYFNVGMTIAASENLTIVPNLAIGMTDDAPDF
TFSLKFPYYF
Sequence length430 AA
FragmentNo
pHHM coverage74.93 %
Cross-references
UniprotC4IN73
PDB5O65 | 5O67 | 5O68 | 6FUE
EMBLACOQ01000001
InterProIPR036709
Signal peptide annotation
Amino acids1-24
Sequence

MHRSLSLRAVVCLSTLLPASLLYA
Annotation sourceExperimentally verified
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOMMMMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMM
MMMMIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMII
IIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMM
MIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIMMMMMM
MOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIMMMMMMMMMOOOOOOOOM
MMMMMMMMMM
Annotation reliability0.87
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen