Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1054157::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe FadL Outer Membrane Protein (FadL) Family
Protein descriptionMembrane protein involved in aromatic hydrocarbon degradation
Gene nameOrderedLocusNames=Pput_2883
SpeciesPseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
NCBI taxonomy351746
Protein sequence

MKIASVLALPLSGYAFSVHATQVFDLEGYGAISRAMGGTSSSYYTGNAALISNPATLSFA
PDGNQFELGLDVVTTDIKVHDSHGAEAKSSTRSNNRGPYVGPQLSYVAQLDDWRFGAGLF
VSSGLGTEYGSKSFLSQTENGIQTSFDNSSRLIVLRAPIGFSYQATSKLTFGASVDLVWT
SLNLELLLPSSQVGALTAQGNLSGGLVPSLAGFVGTGGAAHFSLSRNSTAGGAVDAVGWG
GRLGLTYKLTDNTVLGAMYNFKTSVGDLEGKATLSAISGDGAVLPLDGDIRVKNFEMPAS
LTLGLAHQFNERWVVAADIKRAYWGDVMDSMNVAFISQLGGIDVALPHRYQDITVASIGT
AYKYNNDLTLRAGYSYAQQALDSELILPVIPAYLKRHVTFGGEYDFDKDSRINLAISFGL
RERVQTPSYLAGTEMLRQSHSQINAVVSYSKNF
Sequence length453 AA
FragmentNo
pHHM coverage97.93 %
Cross-references
UniprotA5W4F4
PDB3BRZ | 3BS0
PfamPF03349
EMBLCP000712
InterProIPR005017 | IPR042117
Signal peptide annotation
Amino acids1-20
Sequence

MKIASVLALPLSGYAFSVHA
Annotation sourceExperimentally verified
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMMMOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMM
MMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIMMMMMMMMMOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen