Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 953077::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Protein beta-barrel domain Family
Protein descriptionAttachment invasion locus protein Ail
Gene nameName=ail, ORFNames=GD372_14930
SpeciesYersinia pestis
NCBI taxonomy632
Protein sequence

MVFMNKTLLVSSLIACLSIASVNVYAEGESSISIGYAQSRVKEDGYKLDKNPRGFNLKYR
YEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFRINEYVSLYGLLGAG
HGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDDVKVGTWMLGAGY
RF
Sequence length182 AA
FragmentNo
pHHM coverage98.87 %
Cross-references
UniprotA0A5P8YI02
PfamPF13505
EMBLCP045258
InterProIPR000758 | IPR011250 | IPR027385
PRINTSPR00316
Signal peptide annotation
Amino acids1-26
Sequence

MVFMNKTLLVSSLIACLSIASVNVYA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMOOOOOOOOOMMMMMMMMMM
MIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIIIIIMMMMMMMMM
MMOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIMMMMMMMMMMMMOOOMMMMMMMMMMM
II
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen