Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 43928::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Porin (OprD) Family
Protein descriptionBenzoate transport porin BenP
Gene nameName=benP1, ORFNames=ABUW_1854, DLI69_13990, GFL19_06935, GNY86_02815
SpeciesAcinetobacter baumannii
NCBI taxonomy470
Protein sequence

MELLHRFKPHTLAVATLFIMCSSSWAANPNQQTEDEWKFTLKNAYINRDFDNDALKDTGS
WSQAASLFYKSKMHDTPLVIADKPITIGADASVQYAVRLSSDKHVADTVLPFNKETQSQA
SDYLKYGATLKLGYDKTLLSVGELWLDLPVTAVDASRQLLTSYWGTNLKSQLSDQLYAEI
GRVEKVSPRNEEDFKKFSFTANGITKESDGLNYIDLRYQFTPSLKGEYYFGNLEDLYNKH
YVGLEHTWKQPTFALTSKFKYFNAKDDGNTFDIDAENIGLLETVKVKNHTFGLGYQQIIG
ESAYPLPDGFLPETYFINWNATGFFKEDEKSYHVMYGYDFKDYIPGLNAMVKYVYGHDFK
AANGEKNHETESNVILNYAFQQPLLKGFALQYIRIDYNVKHGNDFGEDRLFVNYTKKF
Sequence length418 AA
FragmentNo
pHHM coverage97.97 %
Cross-references
UniprotA0A0D5YI36
PDB5DL8
PfamPF03573
EMBLCP008706 | WPIP01000012 | WIGZ01000006 | CP045541
InterProIPR005318 | IPR023614
Signal peptide annotation
Amino acids1-26
Sequence

MELLHRFKPHTLAVATLFIMCSSSWA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOO
MMMMMMMMMMMIIIIIIIIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOO
OOOMMMMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMMOOOOOOOMM
MMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOMMMMMMMMIIIIMMMMMMMMMOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOO
OOOOOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOMMMMMMMMMII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen