Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 9198::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Acinetobacter baumannii 34-kDa outer membrane protein Family
Protein descriptionPutative 34 kDa outer membrane protein
Gene nameORFNames=J567_2083
SpeciesAcinetobacter baumannii 754286
NCBI taxonomy1310668
Protein sequence

MKKLGLATAVLLAMTGAHAYQFEVQGQSEYVDTTANDKNFTGTAQGTYYFKNVDASKGPL
AEAAFLNQASNVSVAYNYIKYDEKDTVNVESHTYGVKGEAYLPTPYLPVYASASYNHTIN
DFKDGVSDDNGDRYALEAGAMLLPNFLVAVGYTSVADQISLDAFGVNKYGIAKAVGESVA
IDEKQDAVTARTKYVGNIDGTNMAIGFEAFGVFAEDNAYGMKTDLFVTPKLSVGASFADV
SAFNSGYDHVWGGHTQYFITPAVAVGADFVKANAKDGNPRDTQTIGLNAKFRF
Sequence length293 AA
FragmentNo
pHHM coverage99.64 %
Cross-references
UniprotA0A062F4L9
PDB6GIE
PfamPF16956
EMBLJMNU01000041
InterProIPR031593
Signal peptide annotation
Amino acids1-19
Sequence

MKKLGLATAVLLAMTGAHA
Annotation sourceExperimentally verified
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOMMMMMMMMMMIIIIIIIIIII
IIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOMMMMMMMMMMIIIIIIIMMMMMMMMMOOO
OOOOOOOOOOOMMMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMMIIIIIIIIIIMMMMMMMMMMOOMMMMMMMMMIIIIIIMMMMMMMMM
OOOOOOOOMMMMMMMMMIIIIIMMMMMMMMMMOOOOOOOOOOMMMMMMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen