Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1188463::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionPutative outer membrane receptor for iron transport
Gene nameORFNames=PAMH27_5021
SpeciesPseudomonas aeruginosa MH27
NCBI taxonomy1306165
Protein sequence

MSRQSTDTAVSSQRLLASAIGVAITAIAAPQAAHADEAGQKKTDKDRVLSLDAATIVGEQ
QDETTYNVDRSASKKYTAPLLDTPRSVTVVPKQVIKDTAAVSLQDALRTVPGITFGAGEG
GNPTGDRPFIRGFDAQSDTYVDGVRDTGAQTREIFNLEQIEVSKGPNSAFGGRGSAGGSL
NLVSKQAKAGNFIDGGFTYGSDQTRRYTLDLNQEFLDGNAAFRLNLLKHDANVAGRDEVD
VSRWGVAPSLTFGLGSPTRVTVSHYHLESDDTPDSGIPYAKSSDRSKHNPDKPVNVDRGN
FYGLTGRDFQKSRIDTSTITVEHDLTDSLTIRNTSRYGNSHQDYLWTQPDDSQGNINNGS
VWRRQNNRVSTTTTAVNQTDLFGEFYLGGFKNSFSTGLEFSREDSKRDGYIVDTNTGLGS
NKCNPSLIGAPSGYNCTSLENPNPHDPWNGSITRKYAPLNTVGTTKAIYAFDTIDLNEQW
QVNIGARFDSFETTAKNHGVRPATKLSDKSSFWNWQAGLVWKPVPNGSIYASYATSATPP
GSMLDNGDTSNAVDGFAISNNLEPEETTNYELGTKWAFFNERLELSAAIFRTDKDNTRIL
VANQTYDNAGQSRVDGVELSASGKLTEKWKVFAGYSYLDSELVDAGKAGRNGNVNASAAS
NNGNEMPNTPKNSFSLWTTYDIFPKTTIGGGAFYVDKVYGDVGNTVYVPDYWRYDAMASY
KLSKNVDFQLNVQNVFDKKYFDKAYAAHYASQAAGRTILFSTNFHF
Sequence length766 AA
FragmentNo
pHHM coverage91.98 %
Cross-references
UniprotV6ALN4
PDB5NEC
PfamPF07715 | PF00593
EMBLCBTR010000022
InterProIPR030148 | IPR012910 | IPR037066 | IPR039423 | IPR000531 | IPR036942 | IPR010917 | IPR010105
PROSITEPS01156
Signal peptide annotation
Amino acids1-35
Sequence

MSRQSTDTAVSSQRLLASAIGVAITAIAAPQAAHA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIMMMMMMMOOOOOOOMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOOO
OOOMMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIIIIM
MMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOO
OOOOOOOOOOOOOOOOMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMM
MMIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability0.94
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen