Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164944::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionFerric alcaligin siderophore receptor
Gene nameName=fauA, Synonyms=fpvA_2, ORFNames=CYO81_07220, D8Z96_07080, NCTC10911_02855
SpeciesBordetella pertussis
NCBI taxonomy520
Protein sequence

MPDPAHFSPAHSRRLRFFAHVLHLLGALFTQHALAQEARTGNDIAQLPAISVTGREISDL
TEGTNAYTTEAMSTATGLTLSPRETPQSVSVVTRQQIEDQGLTDTGAILATAPGISVTRS
DSNRYSFSARGFTIDNFQFDGLVSPILSQWNYGSTDMDAAIYDHVEIVRGATGLMTGSGN
PSAAVNFVRKRPLREFAATFNASVGSWDYVRGDADISVPITEDGRIRSRLVAAYSQGDSY
VHFLDTRRRTFYGVVSADLTPDTVLTTSVEYQHNHSNGFGSGFPLFYSDGSRTDFNRSVA
NNAPWARQDTEATTYFVDLTHRFTNDWKLRAAYSHTDGRYLMKHVYRGGYPDRHTGIIAA
PPAFSNYDGNLDRDDIHFSLSAPFEAFGLRHEVALGWMSIDNHSDIQRYAMVGPAPAIGS
FFDWRRAHIQEPSWADTLSPADDVRTKQTGAYLVGRFALAEPLHLIVGDRWSDWKTKQMY
FGSRREYRIKNQFTPYAGLTYDINDTYTAYASYTEIFQPQNARDTSGGILPPIKSKSYEL
GLKAAYLEGRLNTSAALFQTRQDNLAQVIPGSSIPGFPNMQASRAASGAKVEGIDLEASG
QILPDWNIGASYTHFTTKDASGNPINTNHPRSLFKLYTTYRLPGALHRLTVGGGVDWQSR
MYQAAASPRGNVEVEQDSYALVSLMARFDFNKKLSATLNVNNLFDKKYYDQIGFYSQGWW
GAPRNVMLNLRAQY
Sequence length734 AA
FragmentNo
pHHM coverage94.13 %
Cross-references
UniprotQ9X6A5
PDB3EFM
PfamPF07715 | PF00593
EMBLAF135154 | CP025530 | CP033302 | UFTT01000002
InterProIPR012910 | IPR037066 | IPR039423 | IPR000531 | IPR036942 | IPR010105
Signal peptide annotation
Amino acids1-35
Sequence

MPDPAHFSPAHSRRLRFFAHVLHLLGALFTQHALA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIII
IMMMMMMMMOOOOOOOOOOOOOMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMM
IIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen