Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164788::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Opacity Family
Protein descriptionSurface protein A
Gene nameName=nspA
SpeciesNeisseria meningitidis
NCBI taxonomy487
Protein sequence

MKKALATLIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLR
FAVDYTRYKNYKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSF
SQTSIGLGVLTGVSYAVTPNVDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF
Sequence length174 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ9RP17
PDB1P4T
PfamPF02462
EMBLAF175678
InterProIPR011250 | IPR003394
PIRG81174
Signal peptide annotation
Amino acids1-18
Sequence

MKKALATLIALALPAAAL
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMOOOMMMMMMMMMMMMMIIIIIM
MMMMMMMMMMMMOOOOOMMMMMMMMMMMMIIIIIIIIIMMMMMMMMMMMMMOOOOOOOOM
MMMMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMMMOOOMMMMMMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen