Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164720::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe FadL Outer Membrane Protein (FadL) Family
Protein descriptionTbuX
Gene nameName=tbuX
SpeciesRalstonia pickettii (Burkholderia pickettii)
NCBI taxonomy329
Protein sequence

MKGNYVRAATAICVAICGTHARATDVFNLEGFGPVSRAMGGTGAAFDIGPAAMMENPATL
GLMGEGRHFSLGLDVVSTDIKVTNTATGETASSGNHGNNNGPYFAPQTAFVYRQGRYAFG
AGIFAEGGLGTQYGGSSFLSRTSNGVDTGLDQFSRLLVLRVPFSAAYHVTDKLTVGASVD
AVWTSLNLGTLLDVSQIGTLAGQGRVSGTLVPTLLGVPGLSGGYIDFSRNAPVGGGVQAW
GIGGRLGLTYQVTPDTRIGAAYQAKTHVGDLTGQATLSAVSSVAGNIPLKGDVTVRNFQM
PAQLTVGISHQFNDQLSVSADYQRVFWSSVMKDMNVGFVQSGSAANLDLSLPQNYRDISV
FGIGAEYRYNAKWTFRGGFHYAQEAIPGNMLLAVVPATPTTSLTGGVSYAIGKNDVIDFA
LSVALRKTLDNASQPNTAVPISVTHSQVNAVIAYQKRF
Sequence length458 AA
FragmentNo
pHHM coverage99.77 %
Cross-references
UniprotQ9RBW8
PDB3BRY
PfamPF03349
EMBLAF100782
InterProIPR005017 | IPR042117
Signal peptide annotation
Amino acids1-22
Sequence

MKGNYVRAATAICVAICGTHAR
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMM
MMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMM
MOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIMMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen