Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164343::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionHemolysin activator-related protein
Gene nameOrderedLocusNames=NMB0496
SpeciesNeisseria meningitidis serogroup B (strain MC58)
NCBI taxonomy122586
Protein sequence

MQQQHLFRFNILCLSLMTALPAYAENVQAGQAQEKQLDTIQVKAKKQKTRRDNEVTGLGK
LVKSSDTLSKEQVLNIRDLTRYDPGIAVVEQGRGASSGYSIRGMDKNRVSLTVDGVSQIQ
SYTAQAALGGTRTAGSSGAINEIEYENVKAVEISKGSNSVEQGSGALAGSVAFQTKTADD
VIGEGRQWGIQSKTAYSGKNRGLTQSIALAGRIGGAEALLIHTGRRAGEIRAHEDAGRGV
QSFNRLVPVEDSSNYAYFIVKEECKNGSYETCKANPKKDVVGKDERQTVSTRDYTGPNRF
LADPLSYESRSWLFRPGFRFENKRHYIGGILEHTQQTFDTRDMTVPAFLTKAVFDANKKQ
AGSLPGNGKYAGNHKYGGLFTNGENGALVGAEYGTGVFYDETHTKSRYGLEYVYTNADKD
TWADYARLSYDRQGIGLDNHFQQTHCSADGSDKYCRPSADKPFSYYKSDRVIYGESHRLL
QAAFKKSFDTAKIRHNLSVNLGFDRFGSNLRHQDYYYQHANRAYSSNTPPQNNGKKISPN
GSETSPYWVTIGRGNVVTGQICRLGNNTYTDCTPRSINGKSYYAAVRDNVRLGRWADVGA
GLRYDYRSTHSDDGSVSTGTHRTLSWNAGIVLKPTDWLDLTYRTSTGFRLPSFAEMYGWR
AGVQSKAVKIDPEKSFNKEAGIVFKGDFGNLEASWFNNAYRDLIVRGYEAQIKDGKEEAK
GDPAYLNAQSARITGINILGKIDWNGVWDKLPEGWYSTFAYNRVRVRDIKKRADRTDIQS
HLFDAIQPSRYVVGLGYDQPEGKWGVNGMLTYSKAKEITELLGSRALLNGNSRNTKATAR
RTRPWYIVDVSGYYTVKKHFTLRAGVYNLLNYRYVTWENVRQTAGGAVNQHKNVGVYNRY
AAPGRNYTFSLEMKF
Sequence length915 AA
FragmentNo
pHHM coverage92.37 %
Cross-references
UniprotQ9K0U9
PDB3V89 | 3V8X
PfamPF07715 | PF00593
EMBLAE002098
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531 | IPR010916 | IPR010949 | IPR010948 | IPR010917
PROSITEPS00430 | PS01156
PIRF81196
Signal peptide annotation
Amino acids1-24
Sequence

MQQQHLFRFNILCLSLMTALPAYA
Annotation sourceExperimentally verified
TM annotation
# beta strands24
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIMMMMMMMOOOOOOMMMMMMMMMMMIIIIIMMMMMMMOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOMMMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOMMMMMMMMMIIIIIIMMMMMMMMMOOOOOOOOOOOOMMMMMMMIIIIII
IMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMMMMIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIMMMMM
MMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMMMMMOOOOOOOOOOOO
OOOOOOOOOOOOOOOMMMMMMMMMIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOMMMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMMMMMIIIMMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMMM
Annotation reliability0.91
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen