Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164340::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionUncharacterized protein
Gene nameOrderedLocusNames=NMB1466
SpeciesNeisseria meningitidis serogroup B (strain MC58)
NCBI taxonomy122586
Protein sequence

MAQTTLKPIVLSILLINTPLLAQAHETEQSVDLETVSVVGKSRPRATSGLLHTSTASDKI
ISGDTLRQKAVNLGDALDGVPGIHASQYGGGASAPVIRGQTGRRIKVLNHHGETGDMADF
SPDHAIMVDTALSQQVEILRGPVTLLYSSGNVAGLVDVADGKIPEKMPENGVSGELGLRL
SSGNLEKLTSGGINIGLGKNFVLHTEGLYRKSGDYAVPRYRNLKRLPDSHADSQTGSIGL
SWVGEKGFIGVAYSDRRDQYGLPAHSHEYDDCHADIIWQKSLINKRYLQLYPHLLTEEDI
DYDNPGLSCGFHDDDNAHAHTHSGRPWIDLRNKRYELRAEWKQPFPGFEALRVHLNRNDY
RHDEKAGDAVENFFNNQTQNARIELRHQPIGRLKGSWGVQYLQQKSSALSAISEAVKQPM
LLDNKVQHYSFFGVEQANWDNFTLEGGVRVEKQKASIQYDKALIDRENYYNHPLPDLGAH
RQTARSFALSGNWYFTPQHKLSLTASHQERLPSTQELYAHGKHVATNTFEVGNKHLNKER
SNNIELALGYEGDRWQYNLALYRNRFGNYIYAQTLNDGRGPKSIEDDSEMKLVRYNQSGA
DFYGAEGEIYFKPTPRYRIGVSGDYVRGRLKNLPSLPGREDAYGNRPFIAQDDQNAPRVP
AARLGFHLKASLTDRIDANLDYYRVFAQNKLARYETRTPGHHMLNLGANYRRNTRYGEWN
WYVKADNLLNQSVYAHSSFLSDTPQMGRSFTGGVNVKF
Sequence length758 AA
FragmentNo
pHHM coverage79.65 %
Cross-references
UniprotQ9JZN9
PDB4RDR | 4RDT | 4RVW
PfamPF07715 | PF00593
EMBLAE002098
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531
PROSITEPS00430
Signal peptide annotation
Amino acids1-24
Sequence

MAQTTLKPIVLSILLINTPLLAQA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMM
OOOOOOOOOOMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMM
MMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIMMMMMMMOOO
OOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOMMMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OMMMMMMMMMMMIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMMMIMM
MMMMMMMMMMMMMMMOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability0.91
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen