Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164228::      
Protein information
OMPdb FamilyThe Imp/OstA Family
Protein descriptionLPS-assembly protein LptD
Gene nameName=lptD, Synonyms=impostA, Name=lptD, Synonyms=impostA
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MAVKSLVFRRKFPLLVTGSLLALQPVAALTVQAADQFDCKVSATGGWDCSPLQNANANLP
PRPAHTATSVSTAAAGSSVSGSGGETVEAEPTQRLVTESGGRALKSRSADYSHLDWIPRE
KLTAAQLAEIGPYCGGSYIEPVRPGMDDGAPSDESPTYVSAKASRYEQEKQIATLAGDVV
LRQGSMQVEGDEANLHQLENRGELVGNVKLRDKGMLVVGDHAQVQLDNGEAQVDNAEYVI
HKAHARGSALYAKRSENAIIMLKDGTYTRCEPSSNAWTLKGNNVKLNPATGFGTATNATL
RVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSSTSDTGFTLVTPYYFNLAPNYDATLYPRY
MAKRGMMLEGEFRYLTHSSEGIVNAAYLNDKDDHREGFPDYSKDRWLYGLKNTTGLDSRW
LAEVDYTRISDPYYFQDLDTDLGVGSTTYVNQRGTLTYRGDTFTGRLNAQAYQLATTTDV
TPYDRLPQITFDGFLPYNPGGMQFTYGTEFVRFDRDLDENIYFNDDGSIRGKRPDASLQG
LARATGDRMHLEPGMSLPMTRSWGYVTPTLKYLYTKYDLDLDSQGKTDLNKRDESFDSNQ
DRSLPLVKVDSGLYFDRDTTFAGTPFRQTLEPRAMYLYVPYKDQDSLPVFDTSEPSFSYD
SLWRENRFTGKDRIGDANQLSLGVTSRFIEENGFERASISAGQIYYFRDRRVQLPGLTEK
DLKRLNLDPSGLDNDSWRSPYAFAGQYRFNRDWRINSDFNWNPNTSRTESGSAIFHYQPE
VDPGKVVNVGYRYRADARRFDSSRGTFRYGNENDIIKQHDFSVIWPLVPQWSVLARWQYD
YNKNRTLEAFGGFEYDSCCWKLRLINRYWLDVDDDAFLVQSEKADRGIFLQIVLKGLGGI
VGNKTEMFLDKGIQGYRQREDQAM
Sequence length924 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ9I5U2
PDB5IVA
PfamPF04453 | PF03968
EMBLAE004091
InterProIPR020889 | IPR007543 | IPR005653
PIRC83572
Signal peptide annotation
Amino acids1-33
Sequence

MAVKSLVFRRKFPLLVTGSLLALQPVAALTVQA
Annotation sourceExperimentally verified
TM annotation
# beta strands26
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOMMMMMMMMMIIIIIIMMMMMMMMOO
OOOOMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIM
MMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIMMMMMMMMOOOOOOOOOO
OOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMMIIII
IIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMO
OOOOOOOMMMMMMMIIIIIIIMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen