Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164224::      
Protein information
OMPdb FamilyThe Outer Membrane Porin (OprD) Family
Protein descriptionCis-aconitate porin OpdH
Gene nameName=opdH, OrderedLocusNames=PA0755
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MSTSLPQAARSVRSSRSTTLTTTAVVLAGIAPLGNAAGFLEDSKASLETRNFYMNRDFRD
GPGQSKREEWAQGFILNLQSGYTQGTVGFGLDAMGMLGVKLDSGRGRSGTGLLPKDSDGR
APDTYSKLGLTAKVKVSQSELKVGTLIPKLPSVQPNNGRIFPQIFEGALLTSKEIKDLGF
TAGRLEKTKIRDSSDSEDLALNDKNGRFAGVSADHFDLGGLDYKLTDQLTASYHYSNLQD
VYRQHFVGLLHSWPIGPGELTSDLRFARSTDSGSAKAGGIDNKSLNGMFTYSLGNHAFGA
AWQRMNGDDAFPYLEGSNPYLVNFVQVNDFAGPKERSWQLRYDYDFVGLGIPGLTFMTRY
VKGDNVELAGQSGEGREWERNTELQYVFQSGALKNLGIRWRNATFRSNFTRDIDENRLIV
SYTLPIW
Sequence length427 AA
FragmentNo
pHHM coverage99.75 %
Cross-references
UniprotQ9I5H4
PDB2Y0L | 3T20
PfamPF03573
EMBLAE004091
InterProIPR005318 | IPR023614
PIRH83551
Signal peptide annotation
Amino acids1-35
Sequence

MSTSLPQAARSVRSSRSTTLTTTAVVLAGIAPLGN
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOO
OOOOOOOOOMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMM
MMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMMOOOO
OOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIMMMMM
MMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIMMMMMMM
MMOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOMMMMM
MMMMIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen