Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164188::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionFerrioxamine receptor FoxA
Gene nameName=foxA, OrderedLocusNames=PA2466
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MTATAVVLRNAPSSLDFPRASRLSRSVRAALLSLAMAAGAAPLCASAAEAAAEQARPYAI
PAGQLGDVLNRFAREAGITLSATPAQTGGYSSQGLRGSFTVQQGLARLLADTPLEAEDQG
DGSFVLREAPAKDGDVLNMQAVEVFALGNNLGSTDGYLATHSQIATKTSKPLLETSQTVS
VITREQIDDTASKTVQQAMRYTPGIFTGQVGASNRYDYVVMRGFADNSVDNIYLDGLKAM
GDSGTFSSMQVDPYFLERIDVLKGPSSVLYGRSLPGGLVALTSKKPLYEDYRQITGSIGN
MGQKEMGFDFSGPLDEEKRIAYRLIGLGKGSDTQFDHVKEERYAIAPTLAIDFSDDTTLT
LQGYLQHDPNGGYHGGVPADGTLSHHNGRHISREFFDGEPSKDDFDRTQRMFGYQLEHRI
DDVWSARQNFRYLDSDVDLSQVYAYGWSASEPNKLNRYFSGAREHLQAYIVDNMLQAEFA
TGAARHTLLTGLDYQRRRTVVDWRSGSASALDAFNPVYGDDAISYFPDDNHTRRLEQTGV
YLQDLIDIDQWRFSLGLRQDWVSVTDKNRSTGSKADDDWEKFTGRIGALYLFDNGLAPYV
SYSESFNPNAYSDASGTPLAPTEGKQWELGLKFQAPGSNSFYTASLFHITQENVASKEPQ
DNFYTSVGEVRSQGLELEAHTQLSDNLKLLGSYTYTDITYTKSLDGNQGHTPNQAPKHMA
SLWADYAFDAGPLSGLSIGGGARYVGETWADKENTLRVPDYTLVDARIGYDLGKLGLKGL
DVSLNANNLLDKDYVASCYSLDFCYFGEKRNVTATVNYQF
Sequence length820 AA
FragmentNo
pHHM coverage94.52 %
Cross-references
UniprotQ9I116
PDB6I96 | 6I97 | 6I98
PfamPF07715 | PF00593
EMBLAE004091
InterProIPR012910 | IPR037066 | IPR011662 | IPR039423 | IPR000531 | IPR036942 | IPR010105
SMARTSM00965
PIRD83337
Signal peptide annotation
Amino acids1-40
Sequence

MTATAVVLRNAPSSLDFPRASRLSRSVRAALLSLAMAAGA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMM
MMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMII
IIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIII
IIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIII
IIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMMIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIM
MMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen