Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164166::      
Protein information
OMPdb FamilyThe OmpW Family
Protein descriptionOuter membrane protein OprG
Gene nameName=oprG, OrderedLocusNames=PA4067
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MRKSWLTASLLALTVASPFAAADIQGHKAGDFIIRGGFATVDPDDSSSDIKLDGAKQRGT
KATVDSDTQLGLTFTYMFADKWGVELVAATPFNHQVDVKGLGPGLDGKLADIKQLPPTLL
LQYYPMGGTNSAFQPYGGLGVNYTTFFDEDLASNRKAQGFSSMKLQDSWGLAGELGFDYM
LNEHALFNMAVWYMDIDTKASINGPSALGVNKTKVDVDVDPWVYMIGFGYKF
Sequence length232 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ9HWW1
PDB2N6L | 2N6P | 2X27
PfamPF03922
EMBLAE004091
InterProIPR000758 | IPR011250 | IPR005618
PROSITEPS00695
PIRC83139
Signal peptide annotation
Amino acids1-21
Sequence

MRKSWLTASLLALTVASPFAA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMMMMMIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMM
MMMMMMIIIIIIMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMM
MIIIMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen