Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164159::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Porin (OprD) Family
Protein descriptionProbable porin
Gene nameOrderedLocusNames=PA4179
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MSSPFSPRSPRTLRGLGALALCGGFVAPAPAAFLEDGSARLEARTVYFNRDFRDGSSANP
QGASKREEAAQGFILDLRSGYTEGALGFGVDTLAMLGIKLDSSPADSNSGLLPSSGHDPR
RSVDQYAKAGVAGKMRFSQTQFRYGAMLPDMPLLKYNDGRLLPTLFHGAQLTSEEIAGLR
FSATRLERYTARDSSDAQDIRLHCKNKRYACDTTGNRFDAYQLDYQVNDGLLLQYAQGGL
RNVYRQRYLGAVGKRQVGAGKLSADLRWFDSEDAGAARAGKIDNRALSLLLAYAQGGHTL
SAGWQRMNGASSMPYLDGSNPYLANYLQVNDFANPEERSWQLRYDFDLRSVGVPGLSFMT
RYVNGDHIRLANGDEGKEWERDIELKYIVQSGRFKDLSLRLRNATYRTDFERSARDVDEV
RLIASYNLSLF
Sequence length431 AA
FragmentNo
pHHM coverage99.49 %
Cross-references
UniprotQ9HWK2
PDB4FSO
PfamPF03573
EMBLAE004091
InterProIPR005318 | IPR023614
PIRF83123
Signal peptide annotation
Amino acids1-31
Sequence

MSSPFSPRSPRTLRGLGALALCGGFVAPAPA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOO
OOOOOOOOMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMM
MMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMMOO
OOOOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIMMM
MMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIMMMMM
MMMMOOOOOOOOOOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOM
MMMMMMMMIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen