Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164152::      
Protein information
OMPdb FamilyThe FadL Outer Membrane Protein (FadL) Family
Protein descriptionProbable outer membrane protein
Gene nameOrderedLocusNames=PA4589
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MPLLCALIVGGLFGTSQAQAGGFMVPTTNTAGWGRAMAGGSLFPNDPSAAFNNPAAMAFI
DKRIAQLTVNYADIDIKYNGDAYDYQGNPMTGGYQDGPGTPELGTNDGGQAGFGAWLPTG
FLVVPINDRFAFGLSQVVPMGMRSTWDPNWKGRDFAVDTKIETIGLTGSLSFKVNDNFSL
GAGVIIQRTSGFVSQNLDLYASAANSPGMGGIPFPASNSSALMRVKVDNTSPGFFAGAVW
KPTDRDTLGFAYHAKIRNKLKGHYNLYDHDGGLTEGAIEGGTPGLAYPGLDLRMGASASA
RLDIPAYASLDWVHQFNDRLSLGASATWTEWSSFQDLTLKSHGNTIVSIPYTYRNTWTLA
VGGDYKVTDQWTMRAGVAYDQTPTHNATRDPRIPDGDRYFASLGAGYRFQSMPELSIDAA
YSRQFVKEVPLKTVNQDRLGGGRLDGRATSKGQVFSLSATYDF
Sequence length463 AA
FragmentNo
pHHM coverage99.54 %
Cross-references
UniprotQ9HVJ6
PDB3DWO
PfamPF03349
EMBLAE004091
InterProIPR005017 | IPR042117
PIRA83073
Signal peptide annotation
Amino acids1-20
Sequence

MPLLCALIVGGLFGTSQAQA
Annotation sourceExperimentally verified
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMMIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMM
MMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMM
IIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMM
MMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIIIMMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen