Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1164143::      
Protein information
OMPdb FamilyThe Outer Membrane Porin (OprD) Family
Protein descriptionVanillate porin OpdK
Gene nameName=opdK, OrderedLocusNames=PA4898
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MKIRRKTAVPRNAGAVLPMLACLAAQAAEGGFLEDAKTDLVLRNYYFNRDFRDHDAGKSL
VDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNSGRGTSNSELLPLHDDGRAADNYG
RVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFD
AVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANL
LHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDS
GWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATT
KAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW
Sequence length417 AA
FragmentNo
pHHM coverage99.49 %
Cross-references
UniprotQ9HUR5
PDB2QTK | 2Y2X | 3SYS
PfamPF03573
EMBLAE004091
InterProIPR005318 | IPR023614
PIRH83032
Signal peptide annotation
Amino acids1-27
Sequence

MKIRRKTAVPRNAGAVLPMLACLAAQA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOO
OOOMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMMO
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIMMMMMMMOOOOOOOMMMMMM
MMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIMMMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIMMMMMMMMMOOOOOO
OOOOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen