Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1163922::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOsmoporin Omp36
Gene nameName=omp36, Synonyms=ompC_2, ORFNames=FOB49_02125, NCTC10006_05587
SpeciesKlebsiella aerogenes (Enterobacter aerogenes)
NCBI taxonomy548
Protein sequence

MKVKVLSLLVPALLVAGAANAAEIYNKDGNKLDLYGKIDGLHYFSSDDSVDGDQTYMRIG
VKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVY
DVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSG
EDQTNNGRDFQKQNGEGFGTSVTYDIWDGISAGFAYSSSKRTDEQNNSTFVSKTDGGRYG
VLGEGDHAETYTGGLKYDANNIYLATQYTQTYNATRTGNIGFANKAQNFEVVAQYQFDFG
LRPSVAYLQSKGKDMGRYGDQDILKYVDLGATYYFNKNMSTYVDYKINLLDDNKFTKDAS
ISTDNVVALGLVYQF
Sequence length375 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ9ALY0
PDB5O9C
PfamPF00267
EMBLAF335467 | CP044083 | LR134127
InterProIPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-21
Sequence

MKVKVLSLLVPALLVAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIII
MMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOO
OOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen