Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1163855::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe OpcA Family
Protein descriptionOuter membrane protein
Gene nameName=opc
SpeciesNeisseria meningitidis
NCBI taxonomy487
Protein sequence

AQELQTANEFTVHTDLSSISSTRAFLKEKHKAAKHISVRADIPFDANQGIRLEAGFGRSK
KNIINLETDENKLGKTKNVKLPTGVPENRIDLYTGYTYTQTLSDSLNFRVGAGLGFESSK
DSIKTTKHTLHSSRQSWLAKVHADLLSQLGNGWYINPWSEVKFDLNSRYKLNTGVTNLKK
DINQKTNGWGFGLGANIGKKLGESASIEAGPFYKQRTYKESGEFSVTTKSGDVSLTIPKT
SIREYGLRVGIK
Sequence length252 AA
FragmentYes
pHHM coverage99.60 %
Cross-references
UniprotQ9AE79
PDB2VDF
PfamPF07239
EMBLAJ311619
InterProIPR020080 | IPR009876
Signal peptide annotation
No information available
TM annotation
# beta strands10
Protein topology

IIIIIIIIIMMMMMMMMMMMMOOOOOOOMMMMMMMMMMMMMIIIIIIIIMMMMMMMMMMM
MOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMIIIIIIIIIIIIMMMMMMMMMMM
OOOOOOOOOOOOOMMMMMMMMMMMIIIIIIIIIIIIMMMMMMMMMMMMOOOOOOOOOOOO
OOOOOMMMMMMMMMMMIIIIIIIIIIIMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOM
MMMMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen