Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1163657::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOmpC porin
Gene nameName=ompC, ORFNames=EGK68_01615, NCTC10005_03257
SpeciesEnterobacter cloacae
NCBI taxonomy550
Protein sequence

MKVKVLSLLVPALLVAGAANAAEIYNKDGNKLDLYGKVDGLHYFSDDDSQDGDQTYMRLG
FKGETQVNDQLTGYGQWEYQIQGNSGENENNSWTRVAFAGLKFGDAGSFDYGRNYGVVYD
VTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNSDFFGLVDGLNFAVQYQGKNGSASGE
DQTNNGRTELRQNGDGVGGSITYNLGEGFGIGTAVSSSKRTSSQNDLTYGNGDRAETYTG
GLKYDANNIYLAAQYTQTYNATRVGNLGWANKAQNFEVVAQYQFDFGLRPSVAYLQSKGK
DLENGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDDKEFTRNAGISTDDIVALGLV
YQF
Sequence length363 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ93K99
PDB5FVN
PfamPF00267
EMBLAJ316539 | RHWT01000001 | UGJB01000004
InterProIPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-21
Sequence

MKVKVLSLLVPALLVAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOOOO
OOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMM
MMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen