Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1163507::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Imp/OstA Family
Protein descriptionLPS-assembly protein LptD
Gene nameName=lptD, Synonyms=impostA, Name=lptD, Synonyms=impostA
SpeciesSalmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
NCBI taxonomy99287
Protein sequence

MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVKGDTNDLPVTINADNAK
GNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILK
GPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGSFTSCLPGSDTW
SVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTKNY
FEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLTQAGEGVMELDYLPSDKVYED
DHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKVSDSSYFNDFDSKYGSSTDGYATQKFS
VGYAVQNFDATVSTKQFQVFNDQNTSSYSAEPQLDVNYYHNDLGPFDTRIYGQAVHFVNT
KDNMPEATRVHLEPTINLPLSNRWGSLNTEAKLMATHYQQTNLDSYNSDPNNKNKLEDSV
NRVMPQFKVDGKLIFERDMAMLAPGYTQTLEPRVQYLYVPYRDQSGIYNYDSSLLQSDYN
GLFRDRTYGGLDRIASANQVTTGVTTRIYDDAAVERFNVSVGQIYYFTESRTGDDNIKWE
NDDKTGSLVWAGDTYWRISERWGLRSGVQYDTRLDSVATSSSSLEYRRDQDRLVQLNYRY
ASPEYIQATLPSYYSTAEQYKNGINQVGAVASWPIADRWSIVGAYYFDTNSSKPADQMLG
LQYNSCCYAIRVGYERKLNGWDNDKQHAIYDNAIGFNIELRGLSSNYGLGTQEMLRSNIL
PYQSSM
Sequence length786 AA
FragmentNo
pHHM coverage99.74 %
Cross-references
UniprotQ8ZRW0
PDB4N4R
PfamPF04453 | PF03968
EMBLAE006468
InterProIPR020889 | IPR007543 | IPR005653
Signal peptide annotation
Amino acids1-24
Sequence

MKKRIPTLLATMIASALYSHQGLA
Annotation sourceExperimentally verified
TM annotation
# beta strands26
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOO
OMMMMMMMMMIIIIIIMMMMMMMMOOOOOOMMMMMMMMIIIMMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMM
MMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOO
OOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMMIIIIIIIIMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMM
MMIIIIIIIMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIII
IIIIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen