Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1163493::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe systemic factor protein A (SfpA/LpxR) Family
Protein descriptionPutative outer membrane protein
Gene nameOrderedLocusNames=STM1328
SpeciesSalmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
NCBI taxonomy99287
Protein sequence

MNKYSYCATMIAAILSTTTMANASSLAISVANDDAGIFQPSLNALYGHPAADRGDYTAGL
FLGYSHDLTDASQLSFHIAQDIYSPSGANKRKPEAVKGDRAFSAFLHTGLEWNSLATNWL
RYRLGTDIGVIGPDAGGQEVQNRAHRIIGAEKYPAWQDQIENRYGYTAKGMVSLTPAIDI
LGVNVGFYPEVSAVGGNLFQYLGYGATVALGNDKTFNSDNGFGLLSRRGLIHTQKEGLIY
KVFAGVERREVDKNYTLQGKTLQTKMETVDINKTVDEYRVGATIGYSPVAFSLSLNKVTS
EFRTGDDYSYINGDITFFF
Sequence length319 AA
FragmentNo
pHHM coverage94.77 %
Cross-references
UniprotQ8ZPT3
PDB3FID
PfamPF09982
EMBLAE006468
InterProIPR018707 | IPR037107
Signal peptide annotation
Amino acids1-23
Sequence

MNKYSYCATMIAAILSTTTMANA
Annotation sourceExperimentally verified
TM annotation
# beta strands12
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMMMMIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIM
MMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIII
IIIIIMMMMMMMMMMMOOOMMMMMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
MMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIIMMMMMMMMMMOO
OOOOOOOOMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen