Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1163465::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Imp/OstA Family
Protein descriptionLPS-assembly protein LptD
Gene nameName=lptD, Synonyms=impostA, Name=lptD, Synonyms=impostA
SpeciesYersinia pestis
NCBI taxonomy632
Protein sequence

MKKRFPTLLATLIWTALYSQHTLADLAEQCMLGVPTYDQPLVTGDPNQLPVRINADKTEA
NYPDNALFTGNVIVQQGNSTLTANQVELTQVQKPGEVIPLRTVTATGDVNYDDPQIKLKG
PKGWSNLNTKDTDMDKGKYQMVGRQGRGDADLMKLRDQSRYTILKNGTFTSCLPGDNSWS
VVGSEVIHDREEQVVEVWNARFKIGKVPVFYSPYMQLPVGDKRRSGFLIPNAKFTSNNGF
EFLLPYYWNIAPNFDATITPHYMERRGLQWQNEFRYLLAPGSGTMALDWLPNDRIYTGPD
GTDKNATRWLYYWGHSGVMDQVWRFNINYTRVSDPAYFTDLTSQYGSTTDGYATQIFTAG
YANENWNATLSSKQFQVFTAAGNSNAYRAQPQLDMNYYKNDVGPFDMHVYGQAAKFTSVN
PTNPEASRFHIEPTVNLPLSNSWGSINTEAKLLATHYQQDIPASFADNASNPKLKDSVNR
VLPQFKVDGKVVFDRSMDWATGFTQTLEPRAQYLYVPYRNQDDIYIYDTTLMQSDYSGLF
RDRTYSGLDRIASANQVSTGLTSRIYDDARVERFNVSVGQIYYFSRSRTGNTEAIDNSNA
TGSLVWAGDTFWRINDQLGLKGGAQYDTRLGSLTLGNAIMEYRKDADRMIQLNYRYASPK
YIQAAVPKVYNPDYQQGISQVGTTASWPIADRWAIVGAYYYDTKAKQPASQLVGLQYNTC
CWAVNLGYERKITGWNAQGQTSKYDNKIGFNIELRGLSGGHSLGTAQMLNSGILPYQSAF
Sequence length780 AA
FragmentNo
pHHM coverage99.74 %
Cross-references
UniprotQ8ZIK3
PDB5IXM
PfamPF04453 | PF03968
EMBLAL590842 | AE009952 | AE017042
InterProIPR020889 | IPR007543 | IPR005653
PIRAE0061
Signal peptide annotation
Amino acids1-24
Sequence

MKKRFPTLLATLIWTALYSQHTLA
Annotation sourceExperimentally verified
TM annotation
# beta strands26
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOM
MMMMMMMMIIIIIIMMMMMMMMOOOOOOMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOO
OOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMM
MMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIMMMMMMMMOOOOOOO
OOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOO
OOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMMIIII
IIIMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen