Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1162467::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Protein beta-barrel domain Family
Protein descriptionOuter membrane protein X
Gene nameName=ompX, OrderedLocusNames=y1324
SpeciesYersinia pestis
NCBI taxonomy632
Protein sequence

MVTVLGIVITIWMVFMNKTLLVSSLIACLSIASVNVYAEGESSISIGYAQSRVKEDGYKL
DKNPRGFNLKYRYEFNNDWGVIGSFAQTRRGFEESVDGFKLIDGDFKYYSVTAGPVFRIN
EYVSLYGLLGAGHGKAKFSSIFGQSESRSKTSLAYGAGLQFNPHPNFVIDASYEYSKLDD
VKVGTWMLGAGYRF
Sequence length194 AA
FragmentNo
pHHM coverage98.87 %
Cross-references
UniprotQ8D0Z7
PDB2N2L | 2N2M | 3QRA | 3QRC
PfamPF13505
EMBLAE009952
InterProIPR000758 | IPR011250 | IPR027385
PROSITEPS00694 | PS00695
PRINTSPR00316
Signal peptide annotation
Amino acids1-26
Sequence

MVTVLGIVITIWMVFMNKTLLVSSLI
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMOOOOOOO
OOMMMMMMMMMMMIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMMIIII
IIIMMMMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIMMMMMMMMMMMMOO
OMMMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen