Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1162431::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe VDAC Family
Protein descriptionVoltage-dependent anion-selective channel protein 2
Gene nameOrderedLocusNames=BT_p548227, OrderedLocusNames=BT_p548227, OrderedLocusNames=BT_p548227
SpeciesDanio rerio (Zebrafish) (Brachydanio rerio)
NCBI taxonomy7955
Protein sequence

MAVPPAYADLGKSAKDIFNKGYGFGMVKLDVKTKSASGVEFKTSGSSNTDTSKVVGSLET
KYKRSEYGLTFTEKWNTDNTLGTEINIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKR
EFVNLGCDVDFDFAGPTIHGAAVVGYEGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQL
HTNVNDGSEFGGSIYQKVSDKLETAVNLAWTAGSNSTRFGIAAKYQLDKDASISAKVNNT
SLVGVGYTQSLRPGIKLTLSALVDGKSINSGGHKLGLGLELEA
Sequence length283 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ8AWD0
PDB4BUM
PfamPF01459
EMBLBX470214 | BC042329 | BC062525 | BC164640 | AY394955
InterProIPR023614 | IPR001925 | IPR027246 | IPR030277
PRINTSPR00185
Signal peptide annotation
No information available
TM annotation
# beta strands19
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOMMMMMMMMIIIIIIIIIMMMMM
MMMOOOOOMMMMMMMMIIIIMMMMMMMMOOOOOOMMMMMMMIIIIIIIIIIIMMMMMMMO
OMMMMMMMMIIIIIIIIIMMMMMMMMOOMMMMMMMIIIIIIIIIIIIMMMMMMMOOOMMM
MMMMIIIIIIMMMMMMOOOOOOMMMMMMMIIIIIIIIIMMMMMMMOOOOOOMMMMMMMII
IIMMMMMMMOOOOOMMMMMMMMMIIIIIIIIIIIMMMMMMMMO
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen