Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1161763::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionIron-regulated outer membrane protein
Gene nameName=fetA
SpeciesNeisseria meningitidis
NCBI taxonomy487
Protein sequence

VLDTVTVKGDRQGSKIRTNIVTLQQKDESTATDMRELLKEEPSIDFGGGNGTSQFLTLRG
MGQNSVDIKVDNAYSDSQILYHQGRFIVDPALVKVVSVQKGAGSASAGIGATNGAIIAKT
VDAQDLLKGLDKNWGVRLNSGFASNEGVSYGASVFGKEGNFDGLFSYNRNDEKEYEAGKG
FRNFNGGKTVPYSALDKRSYLAKIGTTFGDGDHRIVLSHMKDQHRGIRTVREEFTVGDAS
SRTNITRQAPSYRETTQSNTNLAYTGKDLGFVEKLDANAYVLEKKRYSADDKDNGYAGNV
VGPNHTRITTRGMNFNFDSRLAEQTLLKYGINYRHQEIKPQAFLNGEFEISGKKKDPKDP
KKEIDKTDEEKAKDKKDMDLVHSYKLSNPTKTDTGAYIEAIHELDGFTLTGGLRYDRFKV
KTHDGKTVSSSNLNPSFGVIWQPHEHWSFSSSHNYASRSPRLYDALQTHGKRGIISIADG
TKAERARNTEIGFNYNDGTFAANGSYFWQTIKDALANPQNRHVSAAVREAVNAGYIKNHG
YELGASYRTGGLTAKVGVSHSKPRFYDTHPKKLLSANPEFGAQVGRTWTASLAYRFQNPN
LEIGWRGRYVQKAVGSILVAGQKDRNGKLENVVRKGFGVNDVFANWKPLGKDTLNVNLSV
NNVFNTFYYPHS
Sequence length672 AA
FragmentYes
pHHM coverage80.04 %
Cross-references
UniprotQ841A2
PDB4B7O
PfamPF07715 | PF00593
EMBLAF439239
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531 | IPR036942 | IPR010105
Signal peptide annotation
No information available
TM annotation
# beta strands20
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIMMMMMMMMMOOOOOMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOMMMMMMMIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIIMMMMMMMOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIMMMMMMMMMOOOOO
OOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMMMMMIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIII
MMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMM
MMMMMMMMMMII
Annotation reliability0.88
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen