Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1161715::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Imp/OstA Family
Protein descriptionLPS-assembly protein LptD
Gene nameName=lptD, Synonyms=impostA, Name=lptD, Synonyms=impostA
SpeciesShigella flexneri
NCBI taxonomy623
Protein sequence

MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAK
GDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILK
GPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTW
SVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNY
FEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYED
EHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFS
VGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNT
RDDMPEATRVHLEPTINLPLSNNWGSINTEAKFLATHYQQTNLDWYNSRNTTKLDESVNR
VMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGL
FRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWEND
DKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYHYAS
PEYIQATLPKYYSTAEQYKNGISQVGAVASRPIADRWSIVGAYYYDTNANKQADSMLGVQ
YSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPY
QNTL
Sequence length784 AA
FragmentNo
pHHM coverage99.74 %
Cross-references
UniprotQ83SQ0
PDB4Q35
PfamPF04453 | PF03968
EMBLAE005674 | AE014073
InterProIPR020889 | IPR007543 | IPR005653
Signal peptide annotation
Amino acids1-24
Sequence

MKKRIPTLLATMIATALYSQQGLA
Annotation sourceExperimentally verified
TM annotation
# beta strands26
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOO
OMMMMMMMMMIIIIIIMMMMMMMMOOOOOOMMMMMMMMIIIMMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMM
MMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOO
OOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMM
IIIIIIIMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIIIII
IIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen