Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1160953::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionHasR protein
Gene nameName=hasR
SpeciesSerratia marcescens
NCBI taxonomy615
Protein sequence

MFIHKGTTPAGRLATAVRAALAAMMLTQPAVALAAQAEASSAQAAQQKNFNIAAQPLQSA
MLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSR
LPTANGDGGALALDSLTVLGAGGNNANDWVYDEPRSVSVISREQMDNRPARHAADILEQT
TGAYSSVSQQDPALSVNIRGIQDYGRVNMNIDGMRQNFQKSGHGQRNGTMYIDSELLSGV
TIDKGTTGGMGSAGTLGGIATFNTVSASDFLAPGKELGGKLHASTGDNGTHFIGSGILAL
GNETGDILLAASERHLGDYWPGNKGDIGNIRINNDTGNYDRYAESIKNNKIPDTHYRMHS
RLAKVGWNLPANQRLQLSYLQTQTASPIAGTLTNLGTRPPYELGWKRTGYTDVMARNAAF
DYSLAPEDVDWLDFQAKLYYVDTQDDSDTYSTSSLLDNGYATRTRLRTYGAQAQNTSRFS
LAPGHDFRANYGLEFYYDKATSDSSRQGMEGVTPAGNRSVASLFANLTYDYDGWLTLEGG
LRYDRYRLRGQTGLSYPDLAKDGQRYTIDNPCKALRLTGCSTTTREDWDVDRDQGKLSPT
LAVAVRPGVEWLELYTTYGKSWRPPAITETLTNGSAHSSSTQYPNPFLQPERSRAWEVGF
NVQQPDLWFEGDRLVAKVGYFDTKVDNYINLAIDRNKPGLVQPSIGNAAYVNNLSKTRFR
GLEYQLNYDAGVFYADLTYTHMIGKNEFCSNKAWLGGRLRYGDGSRRGNFYVEPDAASND
FVTCDGGTQFGSAAYLPGDRGSVTLGGRAFDRKLDAGVTVRFAPGYQDSSVPSNYPYLAD
WPKYTLFDLYASYKLTDSLTLRGSVENLTNRAYVVSYGETLANTLGRGRTVQGGVEYRF
Sequence length899 AA
FragmentNo
pHHM coverage98.83 %
Cross-references
UniprotQ79AD2
PDB2M5J | 3CSL | 3CSN | 3DDR | 5C58
PfamPF07715 | PF07660 | PF00593
EMBLX81195
InterProIPR039426 | IPR012910 | IPR037066 | IPR011662 | IPR000531 | IPR011276 | IPR010949 | IPR036942
SMARTSM00965
Signal peptide annotation
Amino acids1-34
Sequence

MFIHKGTTPAGRLATAVRAALAAMMLTQPAVALA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMM
MOOOOOOOOOOOOOMMMMMMMMMMMMMMMMMMMMMMMMIIIIIIIIIIIIIIIIIIIIMM
MMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIII
IIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMM
MMIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OMMMMMMMIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen