Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1160851::      
Protein information
OMPdb FamilyThe Thermus thermophilus HB27 TtoA Family
Protein descriptionHypothetical conserved protein
Gene nameOrderedLocusNames=TT_C0834
SpeciesThermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)
NCBI taxonomy262724
Protein sequence

MKKGLLAALAGFLTLAMAQKFSVEAGAGFYGGFGGQLAVVAEDLAPGLPLGVRLGVGFAT
SDALDDGYDLGGGTTWGDVKEAGKFSEWGQNVTLSLDVLYKPSGLGLPVEVAPYFGVRYN
FFSGGYTDPEDNLTIKAQTISSNQLGLGLGVRAAYPLMPNLSLVGDLGVDYYFQACFTRV
EEDDSGNKSQSSVCPGDSGYEDVNKFVTQPEWVLKLRLGAAYRF
Sequence length224 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ72JD8
PDB3DZM
EMBLAE017221
Signal peptide annotation
Amino acids1-18
Sequence

MKKGLLAALAGFLTLAMA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIMMMMMMMMOO
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIMMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen