Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1159829::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionPlug domain-containing protein
Gene nameOrderedLocusNames=ECA0878
SpeciesPectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwiniacarotovora subsp. atroseptica)
NCBI taxonomy218491
Protein sequence

MMLLSLLSGPALAQQNDTSADENQQKNNAESEEEQQGDSSSGNSEDTILVRSTPTSQSMG
MQIINAEQIKKMPTGNGSVTELLKNNPNVQFSNTASSSNIPGELAPENVSFHGEKFYNNN
FMVDGLSNNNNINPGANNGELNQQPDGYSPADLPAGGPQSFWINSELIESLEVFDSNISA
KYGDFTGGVVDAKTMDPKLDKSSGKISYRTTRDSWTKYHISEVISEEFYSGTNLYYQPKF
KKHFYSATFNQPLSDKAGFIFAYNRQQSDIPYYHEYLQQWDDQERINETYLLKGTYLTDS
GDIIRMTGMYSPHESKFYKKDVKNGGFTNSGGGYRFNMEWEHNASWGKMTSLAGYQYTED
KTEHEADSYQTWRRFSSGFVSNVIDWSSSGGANGQNSNIGGYGSFATNTSSFSLKQDYEL
NPVSWYGINHQIDFGWETDFYTSRYRRFSDVYTGGVLVVPTGASAGSVVCQSGDELCIPG
EQYSRTRILYPERNVQVSNVNYAAYLQNSMSYGRLEVTPGVRVSYDDFLENLNIAPRFSA
SYDVFGDRSTRLFGGANRYYAGNILAYKMRQGIGSNIQESRISPTAPWTTPTLRTGTNYN
VSDLNTPYSDELSLGLSQRVMSTVWTAKWVNRQGKEQFGRETTTIDGQSYRVMNNKGHTE
GNTFSLEVEPISPHRFSFAEVNWKLGASVTKNKSNSIYYYDSANQDEQRVIFDDKLMYRG
DIDAMNFNTPWRAFLNVNTYFPAVRLSWDQRVGYTAGYKGYTTSSIQVQCPGGSSACNGD
PSFVGGATEYFPTQYDDFISYDWRFSYSQPVYKTQTLDITLDVLNVLDNVVETNQTGTSN
KPIVIYKPGRQFWLGVAYTW
Sequence length860 AA
FragmentNo
pHHM coverage98.83 %
Cross-references
UniprotQ6D8U4
PDB4ZGV
PfamPF07715
EMBLBX950851
InterProIPR012910 | IPR037066 | IPR036942
Signal peptide annotation
Amino acids1-12
Sequence

MMLLSLLSGPAL
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOO
OOOOOOOOOOMMMMMMMMMMMMMMMMMMMMMMMMIIIIIIIIIIIMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIII
IIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOMMMMMM
MMIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOMMMMMMMMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMMMMMIIIIIIMMMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOO
OOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen