Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1159559::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Campylobacter jejuni Major Outer Membrane Porin (MomP) Family
Protein descriptionMOMP porin
Gene nameName=momp
SpeciesCampylobacter jejuni
NCBI taxonomy197
Protein sequence

MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFLNNSNLNNS
KQDHKYRAQVNFSAAIADNFKAFVQFDYNAVDGGTGVDNATNAEKGLFVRQLYLTYTNED
VATSVIAGKQQLNIIWTDNGVDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQGSDLLG
QSTYVGNGKNNNDSFKLDSIGNLYGAAAVGSYDLAGGQFNPQLWLAYWDQVAFFYAVDAA
YSTTIFDGINWTLEGAYLGNSLDSELDDKKTYANGNLFALKGSIEVNGWDASLGGLYYGD
KEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNGDTGRNIFGYVTGGYTFNETVRVGADF
VYGGTKTEATTHLGGGKKLEAVARVDYKYSPKLNFSAFYSYVNLDQGVNTNESADHSTVR
LQALYKF
Sequence length427 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ659I5
PDB5LDT | 5LDV
PfamPF05538
EMBLAJ841785
InterProIPR008439
Signal peptide annotation
Amino acids1-22
Sequence

MKLVKLSLVAALAAGAFSAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMMMMIIII
IIIMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMIIIIIIMMMMMMMOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIMMMMMMMOOOOOOOOMMMMMM
MIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIMMMMMMM
OOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIMMMMMMOOOOOOOOOOOOOOOOOOOOOM
MMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen