Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1159237::      
Protein information
OMPdb FamilyThe VDAC Family
Protein descriptionOuter membrane efflux family protein
Gene nameOrderedLocusNames=MCA1362
SpeciesMus musculus (Mouse)
NCBI taxonomy10090
Protein sequence

MCSFFLVLLLWQNMAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSA
NTETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNT
GKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQS
NFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQV
DPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Sequence length296 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ60932
PDB3EMN | 4C69
PfamPF01459
EMBLU30840 | AK168672 | AK169671 | AK169354 | AK169282 | AK169160 | AL645589 | BC092257
InterProIPR023614 | IPR001925 | IPR027246 | IPR030270
PROSITEPS00558
PRINTSPR00185
Signal peptide annotation
Amino acids1-20
Sequence

MCSFFLVLLLWQNMAVPPTY
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands19
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOMMMMMMMMI
IIIIIIIIMMMMMMMMOOOOOMMMMMMMMIIIIMMMMMMMMOOOOOOMMMMMMMIIIIII
IIIIIMMMMMMMOOMMMMMMMMIIIIIIIIIMMMMMMMMOOMMMMMMMIIIIIIIIIIII
MMMMMMMOOOMMMMMMMIIIIIIMMMMMMOOOOOOMMMMMMMIIIIIIIIIMMMMMMMOO
OOOOMMMMMMMIIIIMMMMMMMOOOOOMMMMMMMMMIIIIIIIIIIIMMMMMMMMO
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen