Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1159065::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOuter membrane protein II
Gene nameName=porB
SpeciesNeisseria meningitidis
NCBI taxonomy487
Protein sequence

EVSRVKDAGTYKAQGGKSKTATQIADFGSKIGFKGQEDLGNGMKAIWQLEQKASIAGTNS
GWGNRQSFIGLKGGFGTVRAGNLNTVLKDSGDNVNAWESGSNTEDVLGLGTIGRVESREI
SVRYDSPVFAGFSGSVQYVPRDNANDVDKYKHTKSSRESYHAGLKYENAGFFGQYAGSFA
KYADLNTDAERVAVNTANAHPVKDYQVHRVVAGYDANDLYVSVAGQYEAAKNNEVGSIKG
KKHEQTQVAATAAYRFGNVTPRVSYAHGFKAKVNGVKDANYQYDQVIVGADYDFSKRTSA
LVSAGWLKQGKGAGKVEQTASM
Sequence length322 AA
FragmentYes
pHHM coverage89.41 %
Cross-references
UniprotQ5RT80
PDB3A2S | 3VZT | 3VZW
PfamPF00267
EMBLAY800116
InterProIPR033900 | IPR023614 | IPR001702 | IPR013793 | IPR002299
PROSITEPS00576
PRINTSPR00182 | PR00184
Signal peptide annotation
No information available
TM annotation
# beta strands12
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMMMMIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIMMMMMMMMMO
OOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIMMMMMMMMMMMOOOOOOOOOOO
OOOOOOOMMMMMMMMMIIMMMMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMMIIIMMM
MMMMMMOOOOOMMMMMMMMMMM
Annotation reliability0.83
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen